General Information

  • ID:  hor006190
  • Uniprot ID:  P31241
  • Protein name:  Molluscan insulin-related peptide 5 A chain
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the cerebral light-green cells which are giant neuroendocrines cells involved in the control of growth.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila , Panpulmonata , Euthyneura , Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa , Spiralia , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  QRTTNLVCECCYNVCTVDVFYEYCY
  • Length:  25(114-138)
  • Propeptide:  MAGVRLVFTKAFMVTVLLTLLLNIGVKPAEGQFSACSFSSRPHPRGICGSDLADLRAFICSRRNQPAMVKRDAETGWLLPETMVKRNAQTDLDDPLRNIKLSSESALTYLTKRQRTTNLVCECCYNVCTVDVFYEYCY
  • Signal peptide:  MAGVRLVFTKAFMVTVLLTLLLNIGVKPAEG
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-P31241-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006190_AF2.pdbhor006190_ESM.pdb

Physical Information

Mass: 346071 Formula: C131H191N31O42S5
Absent amino acids: AGHIKMPSW Common amino acids: C
pI: 3.93 Basic residues: 1
Polar residues: 14 Hydrophobic residues: 6
Hydrophobicity: 12.4 Boman Index: -3389
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 62
Instability Index: 3821.6 Extinction Coefficient cystines: 6210
Absorbance 280nm: 258.75

Literature

  • PubMed ID:  1323019
  • Title:  Characterization of a cDNA clone encoding molluscan insulin-related peptide V of Lymnaea stagnalis.